PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00100162001
Common NameGSBRNA2T00100162001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 875aa    MW: 98302.1 Da    PI: 5.0829
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00100162001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.73e-29179232356
              G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          r++W+++LH+rFv+a++++GGs++AtPk+i+++mkv+gLt++++kSHLQkYR++
  GSBRNA2T00100162001 179 RRKWSEDLHRRFVDALQKIGGSQVATPKQIRDIMKVDGLTNDEIKSHLQKYRMH 232
                          99**************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.71174234IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-25175235IPR009057Homeodomain-like
SuperFamilySSF466891.16E-14175235IPR009057Homeodomain-like
PfamPF002496.9E-6179230IPR001005SANT/Myb domain
TIGRFAMsTIGR015578.2E-25179232IPR006447Myb domain, plants
Gene3DG3DSA:3.40.50.14409.1E-24335420IPR003008Tubulin/FtsZ, GTPase domain
SuperFamilySSF524901.19E-33335412IPR003008Tubulin/FtsZ, GTPase domain
PfamPF106442.2E-36336456IPR019605Misato Segment II tubulin-like domain
CDDcd060603.10E-151336858No hitNo description
PfamPF148812.1E-22476648IPR029209DML1/Misato, tubulin domain
SuperFamilySSF524901.19E-33479649IPR003008Tubulin/FtsZ, GTPase domain
Gene3DG3DSA:3.40.50.14409.1E-24487652IPR003008Tubulin/FtsZ, GTPase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003924Molecular FunctionGTPase activity
Sequence ? help Back to Top
Protein Sequence    Length: 875 aa     Download sequence    Send to blast
MVQTDTDRRM GLNLNISHYS LAKPLSQFLN DVSKIKDNHS KLFEIDGYVG KLEEERKKID  60
VFKRELPLCM LLMNEAIERL KQEASSVQGV ELETDNKKNW MSSAQLWISN TNSQFQSTNE  120
EEDRCVTHNN ANQRGAILSF NVPPPPPPTA PLSLPTSEIL TDYSSRIEQS HPIQKKELRR  180
KWSEDLHRRF VDALQKIGGS QVATPKQIRD IMKVDGLTND EIKSHLQKYR MHIRKHPLHP  240
AKILIASDQH GLLDRETQNL DSPQGPLVDR GCWFSNNGGH SSEEEEKSDG RSWRSGSRRK  300
RQGPCRIIGF KHNQSQELYA VELETGVFVV GERRMREIVT IQVGEFANFV GSHFWNFQDE  360
LLGLASDPES DPIFRNNNLD MDVLYRSGET QQGVSTYTPR LLSINFKGSL GSMSSHGTLY  420
NQASSSRSDS SQTWFGDVDT QRSEPRKRNL FQQSLYEEEA TATEIEDKDI VGSLDETVEC  480
WTDFSKSHYH PQSLYELNGL WMDSHDFNNY GAGKDLFSEA SRGDEICDKL RFFVEECDHI  540
QGVNFLVDDS GGFSPLAGDF LETMADDYTN VPVLLYSLRS PVSQKKTVIN KLHDAVSFSR  600
LSSFCKLFTP IGLPSLTGMK YLSLGDEKPY RSSAVYAAAL HSSTLPFRMQ HTSSDSSEVS  660
NAMDVNTLVQ LLTNRGRQNI VAILDSAMPL EKTLLTNLQT LTPEVTEDVE DNQSVESMCI  720
LGALGSEDQE ATVSEVRNAV DASYDEQRPL FCNLSVSRVP LPVPLPFPSI FGNLVGRKGE  780
ILSSPASDLM CRGSLDVHSV PVATRWRSSS AVLPFLESRM VNLEKLGIQW GAVGSDVVRA  840
WGFGREELQE MRENLAKMVS ELSPHQFSES EDSD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.71860.0microspore-derived embryo| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00100162001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2296761e-115AK229676.1 Arabidopsis thaliana mRNA for tubulin-like protein, complete cds, clone: RAFL19-92-I18.
GenBankAK3172201e-115AK317220.1 Arabidopsis thaliana AT4G37190 mRNA, complete cds, clone: RAFL22-03-N02.
GenBankBT0237311e-115BT023731.1 Arabidopsis thaliana At4g37190 gene, complete cds.
GenBankBT0331521e-115BT033152.1 Arabidopsis thaliana unknown protein (At4g37190) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593210.10.0PREDICTED: protein misato homolog 1-like
RefseqXP_013703484.10.0PREDICTED: protein misato homolog 1-like
TrEMBLA0A078C6D80.0A0A078C6D8_BRANA; BnaC07g46380D protein
STRINGBra017792.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-118G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]